DPCstruct | MC921
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 423 ± 31 aa |
| Standard deviation of domain lengths | 31.06 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7EVC4 | 429-838 | SMGPPRHLMQPPLMHRTNSSGGRGMMMSPSMSMTSSSSPTTSPQGAGSSCCASSSCPPPSGTATTTSSNQWICDYCNVASFSSYEEA… |
| K0STD2 | 290-678 | AQQTMASVAATRHVSLSTPTDVGATASSGLNLASTSETAQPNIAAGRPVARLTIPSDASFLDPVHVLLREECIEVFVADKLGTTQRG… |
| B8CER5 | 108-546 | None |
| B8C310 | 312-753 | None |
| A0A7S2L3H2 | 445-924 | None |
| A0A7S4QZC5 | 1-453 | None |
| A0A7S3LE58 | 1-401 | None |
| A0A1Z5KIJ3 | 198-575 | None |
| A0A1Z5K6U1 | 163-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.