DPCstruct | MC9208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.43 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.93 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 48.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11272 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1FDH0 | 1-67 | MLGAGTGPTDGPVKDPEDWVTGDQPATDAQKFYLDSLARQAGEQIPADLTKAEASEHIDRLQAATGR |
| A0A7W8DXA0 | 1-68 | MSKLDSDPKTNPGSNTEKDPDEWVSGDDPMTGAQASYLKTLSEQAKRPEAFSDKLSKAEASKLIDELR |
| A0A6J6DQ01 | 20-93 | None |
| A0A653SCD3 | 75-137 | None |
| A0A562WIQ2 | 4-69 | None |
| A0A0X3QC84 | 1-64 | None |
| A4YUY2 | 2-61 | None |
| A0A0N0NH97 | 58-124 | None |
| K9HJ34 | 2-71 | None |
| A0A2N5KDL3 | 6-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.