DPCstruct | MC9206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20555 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H5UVL3 | 1-57 | MCPIRPGDPCSLCQPGANGPQDCGLVYLVQDDPDLREIAAEQRRRHVDRARRSRDVP |
| A0A0K1FB63 | 1-58 | MARHVPTPRCPVRPGEPCGLCHPGATGPADCGVVYLALSDPDLREAYRLAREAARRAA |
| A0A239QVU1 | 22-90 | None |
| A0A3S4VKI9 | 1-50 | None |
| A0A6I5VI59 | 7-67 | None |
| A0A160VNF6 | 16-78 | None |
| A0A4T0UPS3 | 8-66 | None |
| A0A8B3FLZ1 | 20-77 | None |
| A0A4R6KE86 | 3-52 | None |
| A0A7C6GI52 | 82-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.