DPCstruct | MC9203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 118 ± 13 aa |
| Standard deviation of domain lengths | 12.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542V987 | 16-118 | AYAGYDLHITKKDFWADESGPCISREEWSNYVKTDNEIQRDDKNSLDDFLVSLELEKFPIWYNPELCEIYTKDPSENAINKLVKISK… |
| A0A1V2BAM1 | 63-180 | MGYYLNIIRKKNYADWEEDSNISMEEWLAYIELDEELELQPEDDNLAAGFCRWLTEVYEDTNDHVWFDYGMGCIGTKNPNEVTIHKM… |
| A0A1W1XWR3 | 8-136 | None |
| A0A3E1NW80 | 1-130 | None |
| A0A3A9V7K7 | 1-123 | None |
| A0A2E0RRT2 | 1-116 | None |
| A0A1H7FR88 | 1-109 | None |
| A0A2N0VCE6 | 13-143 | None |
| A0A4R7HXU0 | 1-131 | None |
| A0A7G5IIC4 | 20-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.