DPCstruct | MC9202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 8.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2AYR0 | 3-149 | TAMINCIIPVSIGGLIYMLGRHDSLKMFQWFQLLHLEAYIYHFRTVYKDSITSGMPAWMLYSLPDALWMYSFTSAVLLSWKRRLTIY… |
| K1RYB0 | 15-148 | SSWRMALAILFFIVGGVIYVSYRVKSLYMFNWFNILGLDNYVDYLRSNIGAYRIPNFVKYSLPDGLWLFAYFLVIKTIYGTEMSKVA… |
| A0A2D8KLC6 | 1-124 | None |
| A0A3S0RAV7 | 13-143 | None |
| A0A7V2ZKC6 | 13-138 | None |
| A0A1V4M9R2 | 35-164 | None |
| A0A2A5D787 | 30-166 | None |
| A0A3C0CEX9 | 40-191 | None |
| A0A0F6YKG3 | 4-132 | None |
| A0A413PAP1 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.