DPCstruct | MC920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 154 ± 28 aa |
| Standard deviation of domain lengths | 27.70 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 67.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834HG51 | 2-107 | EALVDLAWHPVHPIVVSVSHTGLVYIWAKDYTENWSAFAPDFKELEENEEYVEREDEFDLMPEMEKVKESEVDEDNEVDIVTVNVDL… |
| A0A7S1Y220 | 1-137 | FHPTRSYLAVATSDGLVDVWGPRMDWTAFAPDFKALPRNVEYVEDEDEFDVVKASDDTHDATTSSESPMSMDVDDDSDEEVDVVSRD… |
| A0A368FDL1 | 3-135 | None |
| A0A4D9BIG3 | 20-178 | None |
| A0A7S3B478 | 34-183 | None |
| V5GIU3 | 2-131 | None |
| A0A2U1MAJ5 | 298-479 | None |
| A0A6J0ILD3 | 213-356 | None |
| G0SCV3 | 3-162 | None |
| A0A7I4ACH5 | 201-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.