DPCstruct | MC92
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 212 ± 20 aa |
| Standard deviation of domain lengths | 20.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2EDP8 | 1-205 | MRTSVSVLDKRYSDELMIALRLHEISGERVGEVLAEVESHVAETGEDPRAAFGSPKEYAAQVAAQLDARSGKPSPLSYMLGAALTGA… |
| A0A3N1APB7 | 3-196 | EPTATAEPFERWEIPARFALSDRGVGYHLANPIIADVQAHCAYTGQSPYDAFGSPEEFALVAAAEQPAHLRENPDRNGLTPGDYLSG… |
| A0A2V5IMN5 | 15-240 | None |
| A0A1W2DUC3 | 1-211 | None |
| A0A3M0G316 | 18-196 | None |
| A0A2T0UQ79 | 20-240 | None |
| A0A542YV40 | 20-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.