DPCstruct | MC9199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5FUU2 | 479-593 | GRADTTDALTARLDAIMKDIPDFHFGRVDVKAASIEDLRRGENFRIIEINGVGSEATHIWDRGTTLWEAYRAQFSHYRQTFLIGAAN… |
| A0A850LAS7 | 11-119 | TRQLDEILKDVEGYYYGRLDIKFADIESFMAGEQFSILEMNGASSEATHIWDRNTKLSEIFNTLLKQYRILFEIGALQKKRGFKSPS… |
| A0A351Y6C4 | 2-90 | None |
| A0A4Q6AH33 | 63-177 | None |
| A0A1V5KIS1 | 85-193 | None |
| F1VUN5 | 2-110 | None |
| A0A829D7Y9 | 33-168 | None |
| A0A1G9KB55 | 456-581 | None |
| A0A4P5X569 | 724-850 | None |
| A0A351C939 | 523-662 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.