DPCstruct | MC9193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1681 |
|---|---|
| Mean domain length (aa) | 128 ± 27 aa |
| Standard deviation of domain lengths | 26.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 96.16 |
| Assigned Pfam label(s) | PF07851- PF05024- CL0710- CL0287- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846VG31 | 123-233 | AFGELVEHERQTPSLSAEAVSRLIADKADVVVVDARRFDEYRTMSIPTATSVPGAELVLRVRELAPDPATRVVVNCAGRTRSIIGTQ… |
| A0A347AMI4 | 10-117 | EQIIRNISPEEALELIKDMQDDPDFIILDVRTPKEFESGHIEGAINIDFRDENFASTMDERDKEKKYMICCGSGVRSSKALTVMQDC… |
| K8EPH7 | 76-277 | None |
| K8EQB5 | 40-168 | None |
| K8EW28 | 247-362 | None |
| C4M3A7 | 287-406 | None |
| A0A7S4A4U6 | 184-302 | None |
| K8EIW5 | 87-226 | None |
| A0A3D0IDF0 | 4-113 | None |
| A0A2J8AHT8 | 187-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.