DPCstruct | MC9188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 7.16 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z7YTE2 | 3-123 | DPGFRLSLIDILVLLSGAGGAWVLYPHNPNLSIGVAFVVAHFFLFCNIIRMSRIPELIWAFSFIVLSLLSLKFEFLAWNNVLYFSVF… |
| A0A5S9F7N6 | 6-121 | LTSSKKPGFRLSIVDVVFILFSGVATYIVYPYLLSFTWIIPLVVGHFFLFCNVFRVRRNLELLWAAVFCGNIIVHFYTHFSWTTVLM… |
| A0A1T4X943 | 7-119 | None |
| A0A356KT57 | 2-118 | None |
| A0A517YMV7 | 118-243 | None |
| A0A2N9NH36 | 25-146 | None |
| A0A7Y5HFR7 | 20-133 | None |
| A0A7W5H795 | 31-158 | None |
| A0A5C6C4Z9 | 3-114 | None |
| A0A7W1TAU5 | 23-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.