DPCstruct | MC9185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 171 ± 39 aa |
| Standard deviation of domain lengths | 39.14 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 71.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814BEL9 | 1-148 | MPFIEDWITHPMTIINRLHEKSPDTFENDVRNYFQTNIDNPTFYKEIPSLNDRDDEHPLPSGCLVRYRAMIQDMADDEIYCTNYKVR… |
| A0A3L6EMG8 | 2-183 | VGLQYDLVGNPLGAVCATFERTVTAAAEESGGADPVAVFRGKDLGAGDLFRSFLFEQDDLGKVPVLDLSNLGLIKPNTLVRYRGMVQ… |
| A0A814SWE0 | 218-401 | None |
| A0A6I9XVM3 | 1-169 | None |
| D3B6B5 | 408-538 | None |
| A0A4S4EYD0 | 1-204 | None |
| A0A6A3ARB5 | 1-189 | None |
| A0A453E3T7 | 16-202 | None |
| A0A7E4SA23 | 7-202 | None |
| A0A6J0C692 | 15-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.