DPCstruct | MC9184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 54.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6EFR7 | 1-98 | MGVVLMFGGQVPVVKVGRMAGQFAKPRSEPFEEKDSVKLPSYRGGNVNGDDFTEKSRVSDPQRMIRAYAQSVATLNLLRAFATGGYA… |
| A0A6V7QQY7 | 205-274 | SVVLMFGGQMPIVKVGRMAGQFAKPRSDPFEERNGVKLPSYRGDNVNGDAFDEKSRVPDPQRMIRAYCQS |
| L8HFZ7 | 112-201 | None |
| H6SRE3 | 533-602 | None |
| A0A3Q0FJ36 | 211-280 | None |
| M7Z6H5 | 29-113 | None |
| A0A1D6GL05 | 74-164 | None |
| A0A841BQH0 | 108-194 | None |
| A0A2N5V282 | 113-188 | None |
| A0A1D6M073 | 151-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.