DPCstruct | MC9183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 217 ± 19 aa |
| Standard deviation of domain lengths | 19.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402FRN2 | 82-287 | LREFLTMYIKNIFLNQVLGEINKEIEGVTKTTDPLKILANADTMKMLGVQRPLLQSTVIVEKTVQDLMNLMHDLSAYSDQFLNMVCI… |
| A0A3L6E0D9 | 3-207 | RSDGLLAFVNNFLKEHFLPAIFVDYRKCVQQAISSPAAFRPRVHATSAYSSSVELGRPVLQGLLAIDIIAKEVLGWVQLMPNYATEL… |
| A0A816CLW3 | 86-284 | None |
| A0A817NNZ3 | 2-244 | None |
| A0A6P5BCE6 | 2-212 | None |
| A0A1Y3NNP1 | 80-287 | None |
| A0A1S3SI74 | 9-222 | None |
| A0A183R1E0 | 257-440 | None |
| A0A6V7X2J2 | 154-382 | None |
| A0A816QA74 | 249-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.