DPCstruct | MC9180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 152 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 43.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF07839- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6LK75 | 2-152 | ESMKWDVKVLCLTASVCRRLRATAKRLLWRELCLFRAPRITESLSNGVHSSRMLGGWPSLAKLLFFCGGCNSTRNFVMSRSKPGHFV… |
| A0A3L6DRQ7 | 25-171 | SCAVGTWGGGGGGGGGNAASIRGVNVGLMDEKVLRLVFLALNWDPQSLCAVARVSRRLRAVAERVLWRKLCVSRAPRMVAALTGGPA… |
| A0A7J7G966 | 263-375 | None |
| A0A4Y7I8X0 | 7-160 | None |
| A0A1E5V0N6 | 1-110 | None |
| A0A811MW08 | 1-143 | None |
| F6H5M2 | 18-153 | None |
| A0A5N5HQA9 | 379-517 | None |
| A0A427B5U5 | 229-378 | None |
| A0A7J7G8I8 | 178-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.