DPCstruct | MC918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 248 ± 37 aa |
| Standard deviation of domain lengths | 36.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19363 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N1U3D6 | 18-296 | GILSKKSIARFVENIKVLDEWQLHRINPIRFAKQNDFEIGETLDLFLHSAKIGFLDFAYNMICPACGGVAASHTSLDQIEEKSFHCY… |
| A0A7S1VSE6 | 45-297 | IHPMVVAEQSGVPLNDVLTELLCANEVGMVTMRWTPFCGRCASPTCAKDNRVRVPGTAYCPSCRYQTAIDCLEKIKVIFVFSQDVLY… |
| A0A7W0VTA0 | 11-222 | None |
| A0A1F4QH13 | 1-213 | None |
| A0A7S1CXB0 | 66-348 | None |
| A0A7W0Y5F3 | 96-326 | None |
| A0A1V3X452 | 2-191 | None |
| A0A351LDR8 | 157-405 | None |
| A0A7S4KD36 | 49-333 | None |
| A0A534W748 | 184-412 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.