DPCstruct | MC9179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 229 ± 59 aa |
| Standard deviation of domain lengths | 59.20 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538MYK0 | 273-552 | APLLPGLVQHWKARLQGRRGPTPVQPYRDLRRLWGKSAVAVEGTSVVYRLAPSVVAASLGAAVLLVPVAAQAPDWGLGHDVLVLVGL… |
| A0A2E9BDR1 | 146-429 | FQNIADGMKFLMKEHMVPSRADKVIFELAPFLVISSTVMILGMIPLSSGIYGANPELSVLFAFAIFGIAPLGVFFAGWSSNNKYTLL… |
| A0A7V3K3X7 | 2-165 | None |
| A0A3M1E5F3 | 179-474 | None |
| A0A7J3WBW7 | 2-133 | None |
| A0A7C4S8Q0 | 13-173 | None |
| A0A7W0G7H8 | 36-241 | None |
| L0DLG7 | 79-376 | None |
| A0A848X070 | 13-164 | None |
| A0A377BUL3 | 25-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.