DPCstruct | MC9178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8DU40 | 1-131 | VEIAPPEVDEDQEPMPIPPPPDLSMLDSIPVSEKKIENFWPWAQQEEWSGRDVARKVKSAMEAAKSKNIAQATVMLDEVGPHLGDRT… |
| A0A2E8UJL7 | 49-220 | PDINGDPAIESLNDIVIGVDSSQTPGASEARPRISPPKIPEIDSIPNSTIESESESQNESIMKTVDGFLNHDIERVKRPSYWPWAQQ… |
| A0A3A5VHZ4 | 271-447 | None |
| A0A2E9L6N1 | 31-178 | None |
| A0A2E5QG65 | 210-376 | None |
| A0A2E6PYS4 | 347-491 | None |
| A0A6V8DFE7 | 5-155 | None |
| A0A7M3W8Z7 | 83-239 | None |
| A0A2D7JSU8 | 151-339 | None |
| A0A2E5ZXB5 | 146-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.