DPCstruct | MC9177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 166 ± 27 aa |
| Standard deviation of domain lengths | 26.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8TSV9 | 30-207 | QIETEKEISMLLYASFQGPSKLKISKDDLARMWSLEMQWFSPEDASTIVQLLHEHGWLVGAENALSPCRGSLLESPELGWQPFLRAG… |
| A0A2Z2M652 | 3-128 | PLKKAISVKGSKEFSRNELVGLLAFTLRIMSVKEAKESIDRWIKQGLLEEREGVLLVKDEALDEAIKSEDLFEEMIEFVSSSLGLER… |
| A0A257A061 | 4-161 | None |
| A0A7C2N819 | 2-147 | None |
| L9Z665 | 36-175 | None |
| A0A2E7ACX2 | 38-227 | None |
| A0A2D8AMH4 | 75-298 | None |
| M0ATB6 | 1-151 | None |
| A0A7J4F0K7 | 14-173 | None |
| A0A534JM81 | 60-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.