DPCstruct | MC9176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0125- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A399ET13 | 68-143 | ITGTWISGKKVSMLWANSANRNVWLALTDVGWRKFADNSDSAAMAFTVLAANAKATQGQVSVREEADGKIYEIYVW |
| A0A371QQN8 | 276-351 | IYGSAEWLNNQVIQRVYTSHHSQNCWALLQGKGWRKVDTGSVDGTTNLFKNLCYARSSNQEVNLFLENNNIQIMYL |
| A0A351KZJ8 | 40-128 | None |
| A0A076MNI3 | 82-173 | None |
| I1D7J4 | 5-93 | None |
| A0A6G6WM19 | 2-75 | None |
| H0JZN7 | 126-213 | None |
| A0A5N0VJX3 | 118-196 | None |
| A0A5N8XB65 | 93-168 | None |
| A0A5D4GXF3 | 288-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.