DPCstruct | MC9174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 159 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S2I430 | 179-340 | QPYINQLVEDLGKVAQNPPKPTYFETPPHFEELPHIAELSLTPYKTIEELTGIKQMVFPEMTDLFADQCQQVNDAIFKVFEGLNIEL… |
| A0A371QJ35 | 2-140 | RQSAQNLPDPDEASDFESHSLPDEIKMFAGVERYLHGTARPISKITGINPQSFPPLKKLNDAQAAFLLDEMIKLLKAYHFYPDFPKH… |
| A0A2G0CEJ3 | 1-155 | None |
| A0A7V4YX26 | 1-171 | None |
| A0A4V2RQB9 | 5-146 | None |
| A0A4Q8RWT1 | 33-187 | None |
| A0A2T5C486 | 1-164 | None |
| A0A0S8HS28 | 1-162 | None |
| A0A2P7TW03 | 1-172 | None |
| A0A0L8V6G9 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.