DPCstruct | MC9173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 263 ± 38 aa |
| Standard deviation of domain lengths | 38.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF13667- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7PA27 | 20-281 | NSKKVYIEGTRGIAVPMREIHLSGGEPPLRVYDTSGPQDLDVREGLPPLREQWIQERGTHETGRTRELAADVEMPEALKTRTVRGSG… |
| A0A516TJH9 | 28-318 | FPNSKKIYVQGENRGVNVPFREIKVAHNGSGEATDHSFFYAYDTSGPYTDLSAGVEIGSGLFPLRAEWIEQRGDCEPYEGRPIKPED… |
| A0A7C3XTM9 | 25-307 | None |
| A0A0A0IWW9 | 1-206 | None |
| A0A495AAS8 | 3-230 | None |
| W0IQ09 | 14-283 | None |
| X4ZZN4 | 2-256 | None |
| A0A4Y6UBA1 | 13-283 | None |
| A0A2R7QBU0 | 8-298 | None |
| A0A855HM57 | 1-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.