DPCstruct | MC9171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 95.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2I4S3 | 3-77 | LKTVDRYKDSFLDCVLRGVFTVPGDGMINYGHIMQALAEKKYEGWVIVEAEQDPVIADPYEYACIGYEALKKAAE |
| A0A380X5W9 | 56-139 | HLKDVRDEVVEEVRSKNLSFLEGVKKGTFTVPGDGVIDFKPIFEILDKHNYQGWMVVEAEQDPAIANPFEYAVKGRQYIKEVAG |
| A0A7C7K3M8 | 104-189 | None |
| A0A2X3C4U8 | 2-79 | None |
| A0A0V0Q067 | 8-83 | None |
| A0A238JLH2 | 6-91 | None |
| A0A1X1D3Q1 | 14-98 | None |
| A0A117XQY8 | 14-87 | None |
| A0A1V6KDI6 | 2-74 | None |
| G5NLT0 | 152-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.