DPCstruct | MC9170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2KZF5 | 2-71 | LARRLIDQIKSAATRRWSIMEVCGGQTHSIIRHGIDQLLPDIVEMIHGPGCPVCVTPLEVIDKALEIASR |
| A0A353XE72 | 2-93 | GQQADEALLARLSTLIDRPVRVMVVCGTQIRTILKFGISEMVPEQLELVPGPGCSVCVMPEGHIDAYVKIAMQPDVITATCDDLLRV… |
| A0A377LTG4 | 46-136 | None |
| A0A1F2VQY5 | 3-95 | None |
| A0A6A9T187 | 141-249 | None |
| A0A357NG42 | 62-174 | None |
| B6YT82 | 2-90 | None |
| G2DC21 | 17-94 | None |
| A0A520K853 | 9-112 | None |
| A0A451A9P2 | 6-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.