DPCstruct | MC917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 116 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2M7B9 | 2-116 | AGALYKNYLRVCEKWGVDSTKKGRDLGEFIRQLVAKEFSRGEASTIQNLKECEKKLESLNRLASNYYGKQFKRSKYVSATGLSLEEC… |
| A0A085NHV9 | 32-159 | SRRYRLFLNLCKRWPVDDLKSKSGRDLGSRIREEVVSRFDQADNTIITDEAACDRIYEALRDLVNDRHRHDFALNIETGVMGRTLEE… |
| A0A044RQ50 | 1-126 | None |
| A0A0N4V209 | 18-123 | None |
| A0A8B6CAG9 | 2-113 | None |
| A0A7J6A8N5 | 31-162 | None |
| A0A3Q2PJL6 | 91-207 | None |
| T2M612 | 6-125 | None |
| A0A7R9LRI2 | 4-130 | None |
| R7TBZ9 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.