DPCstruct | MC9167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 21.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523DVE1 | 227-319 | TEIIILEAMQQIEALERLTSKLPPLVYEIGLNDACDVAVNALSADELEIYEYLIRYQTIVRVMEESELTDFQVLRHIHSLLARGFFR… |
| A0A349ERP8 | 126-219 | LKVENLLLEGARRADEWVLIQQKIPNFTVVFEPLIGNAEELTRRGLSEMDTNIFSLVDGRRTIQDILDASCLGEFEVAKALFILLSV… |
| A0A7V9DAB5 | 140-236 | None |
| A0A2V7JIC5 | 777-879 | None |
| A0A2M7G9X6 | 456-554 | None |
| A0A7X6AFL1 | 90-180 | None |
| A0A536A9F3 | 124-221 | None |
| A0A660Q2Z7 | 84-192 | None |
| C1A891 | 107-193 | None |
| A0A1V5P8V7 | 574-657 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.