DPCstruct | MC9166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2UUK9 | 2-90 | ISFGKSTSKSYNKAVYLAKNSPKYDEVVDEDGNITHTATYTSSKRDFLDFIVLYDLVSNWKSTFFIINGDLVDKKTVGKIKYCYGDK… |
| A0A1V5JS81 | 14-116 | EKLEDLLGREGRAKRFKITLCFRENLSENSARAVEAAQRLPRYYTEGEGEYLYHCVSGYPEDVEDLHALWQMIQGFENKKVLVNNYP… |
| G2ZT69 | 3-88 | None |
| A0A540VKG6 | 319-398 | None |
| A0A1H2YKW1 | 192-290 | None |
| A0A4R7DUZ6 | 174-266 | None |
| A0A6A7L818 | 4-102 | None |
| A0A525WL36 | 2-81 | None |
| A0A8A7KJ64 | 38-124 | None |
| A0A073INZ1 | 73-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.