DPCstruct | MC9164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 64.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9SA85 | 1-111 | MGFSRTFSSAKAQDLKKPGPAPISIKFGAPKFKDQSTVKKSSSLSVAEAFNQSSDEEEEMPPEAKMRMRNIGRDTPTSAGPNSFGKT… |
| A0A2K6LRT6 | 1-95 | ISKFGFAIGSQTTKKASAISIKLGSIAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHL… |
| A0A6L5CD89 | 17-149 | None |
| A0A084WIY0 | 123-228 | None |
| A0A6P8IUY8 | 1-119 | None |
| E2BEP2 | 45-135 | None |
| A0A3Q7UIF5 | 77-189 | None |
| C4WVJ7 | 11-132 | None |
| H9JD08 | 30-131 | None |
| A0A1Y3EB56 | 76-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.