DPCstruct | MC9162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 155 ± 26 aa |
| Standard deviation of domain lengths | 26.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6AKE8 | 74-207 | NFRATYTVRSATAYHNNVNLSGFDPIPDFQVADSDVTLVSIFSQAEYNGNVTDPLFLATNVSTSSSELYTSTNDLNILGCTEQYQLC… |
| A0A1V1TUM7 | 56-221 | DPDSDFRPVAELERVDGDVIVAFLSGNGVLFHQALDDDWYQATVPSFTLNHKRGAKTGLKYRPLDAASPMGCVQQMQWCNSAYPRDR… |
| A0A178EEN9 | 842-990 | None |
| A0A4V1X0E2 | 40-256 | None |
| W9JB55 | 7-134 | None |
| R1E985 | 30-210 | None |
| A0A6A5ZC39 | 54-159 | None |
| A0A4Q4MU88 | 1-177 | None |
| A0A2V1BEI3 | 338-473 | None |
| A0A0F4GRN6 | 115-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.