DPCstruct | MC9161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 132 ± 19 aa |
| Standard deviation of domain lengths | 19.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 23.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A198AT15 | 1-95 | MEIPIRRRDPKPIKEDLLHVLKLSSEEDMYTAQVNGFSLADIARANQVDVQKVIELQLAELTEQLQLRLFNGSITPEQYLAQRAELP… |
| A0A6I5ZU01 | 8-166 | LAAVAAPLVLGGFLVATQPGSSLAAAGTPVQSTQTTYGPGLGLGLGRAQGGMLGILSKILGLDLADLRAERQAGKSIAGIAAEHGIS… |
| A0A5D0CRL6 | 16-134 | None |
| A0A7Y2EWR6 | 17-159 | None |
| A0A6L3F3D4 | 26-150 | None |
| A0A6J7UJN7 | 1-138 | None |
| A0A3B0CRR7 | 33-172 | None |
| A0A433RKU6 | 9-147 | None |
| A0A366ZSH2 | 80-182 | None |
| A0A2E0RXJ9 | 175-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.