DPCstruct | MC9160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 129 ± 15 aa |
| Standard deviation of domain lengths | 14.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2RKC7 | 259-369 | LVPHFEKMAYDNALLLRAYTHGWQVTGDARLREVAVDTADYLLRELRDERGGFYSSTDADSEGVEGKYFTWTAQEFRQVVAEAGEDP… |
| A0A6I5ZS58 | 1-130 | MVPHFEKMLYDNALLALAYLETRQATGNAVYGRVTREIFTYVLRDITDPEGGFYTAQDAESEGEEGRFYLWTPDQVREVLGTEEGEF… |
| A0A7C5GCN0 | 160-272 | None |
| L8GM78 | 464-609 | None |
| A0A3P6R406 | 170-318 | None |
| A0A183HMQ2 | 114-206 | None |
| A0A7I8CRN8 | 126-255 | None |
| A0A6G1FWR3 | 392-522 | None |
| A0A5N4D5N7 | 921-1053 | None |
| A0A803L9N1 | 609-758 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.