DPCstruct | MC916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 316 ± 41 aa |
| Standard deviation of domain lengths | 41.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077Z490 | 107-485 | EVIPAHFKRTSAVLEGLAMPILEQSTQRFSFLPGQIQRNLKGDEKELLVADIERDMNMLLEQDNYYATAHVLYAAKCAPGPQGPILV… |
| A0A085N3Z8 | 3-363 | GLTLVLLSFFVLQAFGGLFGITPNPKKKLRNASFDMKKPLDVPIGLKEKVQAVVKIIEKLKNGFLRNVTESETVKPEVQERTRIAKS… |
| A0A077ZK03 | 10-368 | None |
| A0A085LL29 | 3-269 | None |
| A0A085LLJ2 | 423-711 | None |
| A0A0V1DYB8 | 1-281 | None |
| A0A085NK36 | 258-537 | None |
| A0A0V0UPC1 | 217-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.