DPCstruct | MC9159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I5ZQY4 | 4-87 | LDKLAYATAAARAARFILTHLRDAEGRLQARYQEGQAAYPAYLDDYAFLTWGLIELYQATFELGYLREALALTRQMQELFRDED |
| A0A5S9LZB9 | 94-183 | DEAISMAKQAMSFLETHLVQHDRLMVRYREGDVKHLGFIEDYAHMLKAYMSLYEATFELAWLEKAAAIAENMFELFWDKEKGAFFFS… |
| A0A7X9CFE0 | 74-163 | None |
| A0A395J824 | 444-525 | None |
| E2B587 | 486-595 | None |
| A0A6G2CKF2 | 3-103 | None |
| X1AJF7 | 1-83 | None |
| A0A538A7K6 | 39-129 | None |
| A0A017TIA1 | 769-858 | None |
| A0A7W1D8C7 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.