DPCstruct | MC9158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4UA79 | 46-151 | RERNEALCESHRNTVHMNTPFLEYDPPFMVEIRCRNIAEFERNNGLSILTPQTCVYDLLRCVQVYKDVHFSRRKVGSNKWYPYVLSN… |
| A0A4S2KX69 | 9-131 | FMQEYRNLCETVTKRVDLIDSEYEYQPPYYHEVYCKGYSLLSEDERIVKQLQQVIIYMSRNLTFFSFQKCAHPAFHCVQRSRILTFV… |
| A0A182WM79 | 58-165 | None |
| A0A0B2VT52 | 100-207 | None |
| A0A2G5UGM1 | 72-177 | None |
| A0A154NY07 | 101-205 | None |
| A0A0D8XMN0 | 32-138 | None |
| A0A183H709 | 1-89 | None |
| A0A151I626 | 150-258 | None |
| B4GBD4 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.