DPCstruct | MC9157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0145- PF04597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A044T2S6 | 388-507 | KFALKMRIVDHLFDDAVIENLKLKIILPEGSNNFKLTTPYPVTRHPDELHFTYLDTTGRPVITIEKDNLVDFHIQMFTLHYEFDRMQ… |
| A0A4S2KVT4 | 158-277 | EFALEMRLLDHVFDDMVVDELVLKIILPEGARNIKLELPYPVTRLPDSLHHTYLDVTGRPVISVTKNNLVENHIQNFRLKYTFPRLL… |
| A0A7E4VRR0 | 7-120 | None |
| A0A194Q3Z0 | 49-163 | None |
| A0A2P6PPA6 | 170-305 | None |
| A0A7S1TBE9 | 246-395 | None |
| A0A267GH44 | 1-105 | None |
| A0A1V9ZXD0 | 337-457 | None |
| A0A4Q4W5K5 | 368-471 | None |
| A0A1J8QDD3 | 557-674 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.