DPCstruct | MC9156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 70 ± 2 aa |
| Standard deviation of domain lengths | 1.70 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 78.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154PMT7 | 1-70 | MSSYTDPLCLNEKTLFRELKTNLPKNIKDTRNILDIRDNVLYVWDAKEFCVVTLNVAATQGKDGEDIPYQ |
| A0A834JMB2 | 33-102 | MSSCTDPLHLNEKRLFKELKRSLSGNTKETHNILEIRDDVLYVWNADKCCVQTLNVGATRGKFDEDVTYQ |
| A0A232FBT6 | 1-71 | None |
| A0A182WNE0 | 1-70 | None |
| A0A0M9A488 | 1-71 | None |
| A0A4Y0BSD4 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.