DPCstruct | MC9155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9VUR4 | 52-151 | KRSWAWQHYTSISKSEIKCNHCNKIYKGLHITSNRKQHLYNFHKISNNNEWKNFKTTHNLVWQYFTKEEGYTAKCTICNQLIKSASH… |
| A0A4S2KPT9 | 13-132 | TSIQSPDETIIMAPRRKHSKLWNYFEELKPTLLKCMTCKKEIKTPNPTIRTKRMRAHILNVHGISLDNDIHTLPDNLRQCYSELPGY… |
| A0A6J1PPA7 | 37-170 | None |
| A0A6V7TSJ3 | 102-205 | None |
| A0A482WYZ9 | 562-687 | None |
| A0A2W1BH36 | 162-287 | None |
| A0A6J3CCU0 | 201-315 | None |
| A0A212EXS3 | 310-414 | None |
| A0A6V7XDC9 | 21-154 | None |
| A0A195FU58 | 14-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.