DPCstruct | MC9154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 6.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 40.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E5WIG9 | 142-204 | WRSQVPPAEQLKTAQGLINAGVELGYIKPDYKLVGHRQVRNTECPGDALFNEIKTWEHYSPYP |
| A0A4S2KJD9 | 15-85 | AEVRKPHAKRSVVPPKLQLRAAQKIIELGVKAGKIAPDYKLLGHRQVSNTVSPRDALYNEIIKWPHWSSEP |
| A0A2G8LL45 | 7-66 | None |
| A0A1B0BG09 | 185-247 | None |
| G9IBU8 | 78-139 | None |
| C3ZNZ6 | 62-130 | None |
| A0A1Y1NDQ6 | 62-127 | None |
| A0A7R8XJV0 | 9-72 | None |
| A0A7R9PR67 | 140-199 | None |
| A0A154P5R0 | 240-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.