DPCstruct | MC9153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.45 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF10044- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I2Z977 | 1-93 | MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSLGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNI… |
| A0A4S2KEU1 | 104-216 | ATDEAPDQPDLSCIEESLMSLEKLDRASPDLWPEQTSNEVPGVHEFVAQNSPQTEPCFWAAMSQEDISHVHQLGNMSMTGLISEVKR… |
| A0A7R9J760 | 27-154 | None |
| A0A6P4YMT4 | 3-135 | None |
| A0A1U7T940 | 45-147 | None |
| A0A6J3IP84 | 33-129 | None |
| A0A813P0C7 | 112-240 | None |
| A0A369S9J9 | 37-149 | None |
| A0A667GBA7 | 46-162 | None |
| A0A0C9RKR1 | 44-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.