DPCstruct | MC915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Standard deviation of domain lengths | 25.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.89 |
| Pfam Score | 91.37 |
| Assigned Pfam label(s) | CL0347- PF14935- PF09799 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085N3W6 | 11-174 | QAENSDLVLSTTELASSLPLQMAIYFNAYFAPCWLIAHIYTLVQKYELLDVTHRSIVLALHLLMVVVEMVRLYVGFLGNITENVVSQ… |
| A0A671QFK8 | 6-142 | KVSQLSSTPLQILFHLNGWYFAAFFIAEILMFIYKGVILPYPQANLILDVVLLLLFLGLETLRLFYGWKGNLCQRSLALFVSVAVLV… |
| E9G4T7 | 23-173 | None |
| A0A553MZH2 | 93-246 | None |
| A0A3L8E444 | 2-134 | None |
| A0A044V5D2 | 26-148 | None |
| A0A0M3HYN9 | 50-197 | None |
| A4FUY9 | 21-187 | None |
| A0A812U867 | 1-189 | None |
| A0A183B2U3 | 15-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.