DPCstruct | MC9148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.37 |
| Pfam Score | 89.01 |
| Assigned Pfam label(s) | CL0040- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0IUN6 | 69-135 | YCISRAANRLPLQLEDAARSEAELRELKLPRVEQNTRLDNRIIDLRTAASQGILRIQSATCALFREH |
| A0A6A6KRI2 | 142-217 | RAVEVQVRKLHCISKAMPTLPINIEDAARSEKEIEEALQAGEQLVRVNQDTRLNYRVLDMRTPANQGIFYISMKLA |
| A0A6J5X3U8 | 58-138 | None |
| A0A803M5I9 | 134-210 | None |
| A0A2Z6M1V1 | 4-93 | None |
| A0A059A2D6 | 166-242 | None |
| A0A7J7H0W5 | 95-179 | None |
| A0A0D3DSU0 | 77-157 | None |
| A0A5A7PJ11 | 709-795 | None |
| A0A498IXB8 | 104-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.