DPCstruct | MC9147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401FJK9 | 18-86 | YDVIVVGAGHAGCEAALAAARMGNKTLLMTINLDMVAFMPCNPSIGGPAKGIVVREVDALGGEMGRNID |
| A0A6A6KRC4 | 30-106 | VGTIDERYDVIVVGGGHAGCEAALASARLGAKTLLLTLNIDRIAWQPCNPAVGGPAKSQLVHEVDALGGEIGKVADR |
| A0A223M944 | 2-80 | None |
| E4LN30 | 2-80 | None |
| E7G4A0 | 1-70 | None |
| A0A447TRR0 | 1-75 | None |
| A0A826PSW3 | 1-70 | None |
| A0A3M7KZW5 | 25-94 | None |
| A0A0G4NPT1 | 713-810 | None |
| A0A5B0QDR4 | 1-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.