DPCstruct | MC9145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 69 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.80 |
| Pfam Score | 63.10 |
| Assigned Pfam label(s) | CL0123- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067DZ64 | 2-68 | LQLLASCSFLTCNLVTNKDGNVFRVYGLASVGRYLLPNEDGVSLAPIFLLSQENVNVDPWYHLKDCL |
| A0A6A6KNG6 | 2-63 | LRLLATYDIVKCSSNTKENGEVERLYAPGPICKFLTKNKNGSGSAAPLLLLHHDEVFMKSWM |
| A0A1R3IGQ0 | 72-159 | None |
| A0A396GME3 | 6-73 | None |
| A0A068VDZ3 | 6-92 | None |
| A0A3N7FYE8 | 50-117 | None |
| A0A2P5WXY8 | 23-90 | None |
| A0A6L2JNQ1 | 79-143 | None |
| A0A7J6F9P2 | 82-143 | None |
| A0A4S4E3X8 | 169-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.