DPCstruct | MC9141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 12 aa |
| Standard deviation of domain lengths | 11.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 63.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830CQJ2 | 2-85 | RAVHVSVYDKDPDEHVRPTVVPDDIIQPLPETYWAPHPKTGVFSPTSNHKLASSGENTNADANSSLEQKAFFRPLEDLDKPVQP |
| A0A6A6KI89 | 1-114 | MLSIPFYKPEKRKDGRLLIFIWRAAHTSVYDKNLDDQVQPSVVPDDVIQPQSNKYWAPHPQTGVFGPATDAHSASGRESGFSTASAN… |
| A0A6P8C9I6 | 36-158 | None |
| A0A199UPM4 | 68-170 | None |
| A0A067JG98 | 18-124 | None |
| A0A834YFI0 | 73-183 | None |
| A0A251VF36 | 5-112 | None |
| A0A4P1QU82 | 1-100 | None |
| A0A1S4AR13 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.