DPCstruct | MC914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9HWM8 | 91-218 | ITRQEIDTKTVDVNQYAPNGDGIVSVTITPYEVDVEMGYDEGKVQPGYERFDSIQSVMLDGSGKLIEDNIGLFSPDGYDLSMITVYY… |
| A0A3B9CIJ1 | 11-142 | ETVRGSWKFPEFSIAQSDKEMQVIEIGETNEAGFGLDRIEVSPVELTVYDIFPEDHLVMTVVLDKDGRKLTYAGNNTNELAVSGYDI… |
| A0A6N2U2R1 | 407-532 | None |
| F0Z1W9 | 164-292 | None |
| A0A1Y4F750 | 307-430 | None |
| C0FWJ8 | 53-182 | None |
| A0A373HZH8 | 246-375 | None |
| A0A6N7WBK8 | 1-129 | None |
| A0A1Q6TDV5 | 241-370 | None |
| A0A373SQC9 | 166-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.