DPCstruct | MC9139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0GFK3 | 86-143 | PLARCANPTCGTIETKIKEFHKCSKCNRVAYCSRTCQAHHWKPSHKKLCVSNDSAYPS |
| A0A6A6KDJ8 | 3-89 | EWFACRGGTPGPGLRLCSHVGCGRPETRKHEFRRCSVCGAVNYCSRACQALDWKLRHKEECAPVERWIDEDGEGGDGEAGEGGLGRG |
| A0A7R9KEC9 | 1-78 | None |
| A0A2I0X4H6 | 88-192 | None |
| A0A4U0X1I0 | 360-438 | None |
| I3SL80 | 27-114 | None |
| I1CGT7 | 170-244 | None |
| A0A2N0Q4A1 | 396-478 | None |
| A0A0B7NNQ4 | 288-363 | None |
| A0A2U1JDX6 | 441-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.