DPCstruct | MC9138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF04718- CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811QKX8 | 1-94 | MRYGKYCGVSYTGCPGESPCDVIDACCMLHDACVQATDNDYLNLWCNQSLLDCVAAARPMAVAATFRGNRCNVTEVADEITTVVEAA… |
| A0A6A6K8J3 | 87-202 | ELKVEDAGIAALFGLECFAWYCAAVGIRYGKYCGVGWTGCPGEKPCDDLDACCKIHDECVEKKGLMSIKCHEKFKSCIKKVKKSGKV… |
| A0A2P5E1U1 | 9-92 | None |
| A0A2P5E1V2 | 97-211 | None |
| A0A0D2ND28 | 102-247 | None |
| A0A4S4DBT8 | 11-136 | None |
| K4AGM7 | 10-120 | None |
| A0A396HIF9 | 90-224 | None |
| A0A4S8JFZ7 | 359-481 | None |
| A0A816LNH7 | 56-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.