DPCstruct | MC9137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 179 ± 13 aa |
| Standard deviation of domain lengths | 13.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6K8G6 | 134-326 | TALVLLEELQKISVMERLNTHKVLDTIDIHQKALDDLVNVNSLFTIAVFVGLSLAHPGEHSLEDRAECDPDRRLAKRLVVSEVLSFA… |
| A0A059CGE0 | 16-209 | DEELVDEKKYFQKVLDDIVSLNSLFTVAVFIGLSFAQPGQVQSLADDPRCHPGANLRKRLVAFEIASFSSFIFAGFLAKSVKVFLYI… |
| A0A5N5FZX7 | 5-190 | None |
| A0A484KF49 | 5-166 | None |
| A0A834L792 | 205-378 | None |
| A0A2I0L1H7 | 41-224 | None |
| A0A7J7DYM1 | 1-196 | None |
| A0A2K1J283 | 31-213 | None |
| A0A5B6WKN2 | 3-186 | None |
| V4TL82 | 16-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.