DPCstruct | MC9136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 155 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A890VW41 | 176-320 | PIQGYHSLRQLVKLSKLEVPQQIKDVIEPIKDNDAAIRNYGIEQAVSLCQELLASGLVPGLHFYTLNREVATIEVLKRLGLWIEDPR… |
| A0A6A6K2M2 | 26-207 | KDLEYLKRKVFLLPVLVNTTEVTAALEPIKDNEEAVRAYGIHLGIEVCKKILAHGIKTLHLYTLNMEKSTLAILMGFSMSNLGLIDE… |
| D0RM84 | 23-167 | None |
| A0A183U4M9 | 85-241 | None |
| A0A5A8EG81 | 262-405 | None |
| A0A7S0JU46 | 89-232 | None |
| A0A7J6UDX8 | 5-168 | None |
| A0A146H906 | 219-369 | None |
| B5VIK4 | 22-218 | None |
| A0A7J7ZZI5 | 210-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.