DPCstruct | MC9135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 81.79 |
| Assigned Pfam label(s) | CL0023- CL0753- PF02823- CL0286- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6JZ62 | 5-109 | GVEFVSPERKLTFVDVCSLSARTPTGALMVMAHHERAVMDLLPGGVVLRDVSSVVDIIVVSNAVMSIRDNVCNIMADMIVLSKDCAE… |
| A0A2H0LGF4 | 2-73 | LRVRLVHAHQQVFHGPAAQVVLPAEWGELSVLEAHAPMLCVLTQGSVQIDETRFPVRRGLAGVSHNMVTIVT |
| A0A7V2LMB2 | 4-126 | None |
| A0A444WPW6 | 176-267 | None |
| A0A5N6PYX2 | 137-237 | None |
| G0PG94 | 39-157 | None |
| A0A5N6PUK3 | 67-203 | None |
| A0A1R3L3P1 | 105-192 | None |
| A0A445CQK6 | 237-339 | None |
| A0A1A8YW26 | 8-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.