DPCstruct | MC9131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 110 ± 7 aa |
| Standard deviation of domain lengths | 6.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4U4L6 | 3-110 | NNIVTVAYIAAIILFILSLGGLSNQETAKRGNLYGIIGMALAVGATALGAAISNYTVLIAVIVLGVVIGAFLASRVEMTEMPELVAV… |
| A0A090RQ66 | 1-105 | MSAGLVQAAYIIAALFFILSLAGLSKQESARQGNYYGIVGMAIALIATIFSPDAQGFGWIIVAMAIGGTIGIFYARKVEMTEMPELV… |
| V4Y0F7 | 5-118 | None |
| A0A6L3ZW79 | 7-125 | None |
| A0A0R3THY2 | 1-107 | None |
| M2QGK1 | 19-143 | None |
| A0A136L0L7 | 2-108 | None |
| A0A0L0FMT5 | 9-114 | None |
| A0DQL7 | 26-130 | None |
| K8CNL1 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.